Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-64 (HV364)

This Recombinant Human Immunoglobulin heavy variable 3-64 (HV364) spans the amino acid sequence from region 21-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-64 IGHV3-64

UniProt

A0A075B6Q5

Expression Region

21-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGEGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMGSLRAEDMAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSC Mouse Monoclonal Antibody
BF8786-01 100 µL

GSC Mouse Monoclonal Antibody

Sign In for Pricing
View Details
GSC Mouse Monoclonal Antibody
BF8786-02 200 µL

GSC Mouse Monoclonal Antibody

Sign In for Pricing
View Details
DHX8 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-14324R-BF680 100 µL

DHX8 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Taar9 shRNA (UAS) - Lentiviral mouse Taar9 shRNA (UAS, GFP) (100)
GTR15287037 1 Vial

Lentiviral mouse Taar9 shRNA (UAS) - Lentiviral mouse Taar9 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Human GCLC qPCR Primer Pair
QH14961S 200 Tests

Human GCLC qPCR Primer Pair

Sign In for Pricing
View Details
Arzoxifene
441798-01 2.5 mg

Arzoxifene

Sign In for Pricing
View Details