Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 2 (TRGV2)

This Recombinant Human T cell receptor gamma variable 2 (TRGV2) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 2 TRGV2 TCRGV2

UniProt

A0A075B6R0

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGRTKSVIRQTGSSAEITCDLAEGSNGYIHWYLHQEGKAPQRLQYYDSYNSKVVLESGVSPGKYYTYASTRNNLRLILRNLIENDFGVYYCATWDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MT ND3 (ND3) Rabbit Polyclonal Antibody
TA371433 100 µL

MT ND3 (ND3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SOX4 Human Gene Knockout Kit (CRISPR)
KN209139RB 1 Kit

SOX4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SureTherm CO2 Incubator, 180L with High heat Decontamination, 230V
H3565-180HD-E 1 Each

SureTherm CO2 Incubator, 180L with High heat Decontamination, 230V

Sign In for Pricing
View Details
PNPO Antibody
KC-28408-01 50 μL

PNPO Antibody

Sign In for Pricing
View Details
PNPO Antibody
KC-28408-02 100 µL

PNPO Antibody

Sign In for Pricing
View Details
PNPO Antibody
KC-28408-03 1 mL

PNPO Antibody

Sign In for Pricing
View Details