Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 2 (TRGV2)

This Recombinant Human T cell receptor gamma variable 2 (TRGV2) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 2 TRGV2 TCRGV2

UniProt

A0A075B6R0

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGRTKSVIRQTGSSAEITCDLAEGSNGYIHWYLHQEGKAPQRLQYYDSYNSKVVLESGVSPGKYYTYASTRNNLRLILRNLIENDFGVYYCATWDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CNTNAP5 Antibody
NBP2-56454 100 µL

Rabbit Polyclonal CNTNAP5 Antibody

Sign In for Pricing
View Details
EPS8 Rabbit Polyclonal Antibody
orb666600-01 30 µL

EPS8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EPS8 Rabbit Polyclonal Antibody
orb666600-02 50 μL

EPS8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EPS8 Rabbit Polyclonal Antibody
orb666600-03 100 µL

EPS8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EPS8 Rabbit Polyclonal Antibody
orb666600-04 200 µL

EPS8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ANKRD53 (NM_024933) Human Tagged ORF Clone
RC206701 10 µg

ANKRD53 (NM_024933) Human Tagged ORF Clone

Sign In for Pricing
View Details