Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-4 (HV404)

This Recombinant Human Immunoglobulin heavy variable 4-4 (HV404) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-4 IGHV4-4

UniProt

A0A075B6R2

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSGTLSLTCAVSGGSISSSNWWSWVRQPPGKGLEWIGEIYHSGSTNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome P450 26C1 Antibody
8C12255-AAT 50 µg

Cytochrome P450 26C1 Antibody

Sign In for Pricing
View Details
Vitamin D Receptor (VDR) (NM_000376) Human Over-expression Lysate
LY424760 100 µg

Vitamin D Receptor (VDR) (NM_000376) Human Over-expression Lysate

Sign In for Pricing
View Details
SUMO-1 (SM1/495), CF568 conjugate, 0.1mg/mL
BNC680495-100 1x 100 µL

SUMO-1 (SM1/495), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS802051 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Recombinant Nucleolin (phospho T76) Antibody
RC-16643-01 50 μL

Recombinant Nucleolin (phospho T76) Antibody

Sign In for Pricing
View Details
Recombinant Nucleolin (phospho T76) Antibody
RC-16643-02 100 µL

Recombinant Nucleolin (phospho T76) Antibody

Sign In for Pricing
View Details