Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-4 (HV404)

This Recombinant Human Immunoglobulin heavy variable 4-4 (HV404) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-4 IGHV4-4

UniProt

A0A075B6R2

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSGTLSLTCAVSGGSISSSNWWSWVRQPPGKGLEWIGEIYHSGSTNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-FRA1 (Ser265) Rabbit Polyclonal Antibody (PE)
orb504981 100 µL

Phospho-FRA1 (Ser265) Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Cryopreserved Brachiocephalic Artery Endothelial Cells (HBcAEC), adult
3012-05a 1 Cryovial

Cryopreserved Brachiocephalic Artery Endothelial Cells (HBcAEC), adult

Sign In for Pricing
View Details
GPD1L protein (His tag)
80R-1970 0.1 mg

GPD1L protein (His tag)

Sign In for Pricing
View Details
MAP3K12
568074-01 50 µg

MAP3K12

Sign In for Pricing
View Details
MAP3K12
568074-02 100 µg

MAP3K12

Sign In for Pricing
View Details
G3bp1 Rat Pre-designed siRNA Set A
HY-RS24378 1 Set

G3bp1 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details