Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 2D-24 (KVD24)

This Recombinant Human Probable non-functional immunoglobulin kappa variable 2D-24 (KVD24) spans the amino acid sequence from region 20-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 2D-24 IGKV2D-24

UniProt

A0A075B6R9

Expression Region

20-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GDIVMTQTPLSSPVTLGQPASISFRSSQSLVHSDGNTYLSWLQQRPGQPPRLLIYKVSNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCTQATQFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-LRP6 (Ser1490) Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-3253R-BF488-TR 20 µL

Phospho-LRP6 (Ser1490) Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Docosahexaenoic Acid (DHA) CLIA Kit
abx490544-01 96 Tests

Docosahexaenoic Acid (DHA) CLIA Kit

Sign In for Pricing
View Details
Docosahexaenoic Acid (DHA) CLIA Kit
abx490544-02 5x 96 Tests

Docosahexaenoic Acid (DHA) CLIA Kit

Sign In for Pricing
View Details
Docosahexaenoic Acid (DHA) CLIA Kit
abx490544-03 10x 96 Tests

Docosahexaenoic Acid (DHA) CLIA Kit

Sign In for Pricing
View Details
(6S) -5- (tert-butoxycarbonyl) -5-azaspiro[2.4]heptane-6-carboxylic acid
sc-357230 250 mg

(6S) -5- (tert-butoxycarbonyl) -5-azaspiro[2.4]heptane-6-carboxylic acid

Sign In for Pricing
View Details
PDCL3 Recombinant Protein (Human)
RP022858 100 µg

PDCL3 Recombinant Protein (Human)

Sign In for Pricing
View Details