Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29)

This Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29) spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-29 IGKV2D-29

UniProt

A0A075B6S2

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQPPQLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIQLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRGN, ID (Neurogranin, Ng, RC3) discontinued. See 299471
N2171-15A 50 µg

NRGN, ID (Neurogranin, Ng, RC3) discontinued. See 299471

Sign In for Pricing
View Details
IGFL1 Peptide
DF2517-BP 1 mg

IGFL1 Peptide

Sign In for Pricing
View Details
CLEC2D (NM_013269) Human Tagged Lenti ORF Clone
RC213794L2 10 µg

CLEC2D (NM_013269) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
APRIL (TNFSF13) (NM_172087) Human Untagged Clone
SC312571 10 µg

APRIL (TNFSF13) (NM_172087) Human Untagged Clone

Sign In for Pricing
View Details
CSRP2BP (KAT14) CytoSection
TS403509P5 25 Slides

CSRP2BP (KAT14) CytoSection

Sign In for Pricing
View Details
MEF2A, phosphorylated (T312) (Myocyte-specific Enhancer Factor 2A, Mef2, ADCAD1, RSRFC4, RSRFC9) discontinued
211966-01 50 µL

MEF2A, phosphorylated (T312) (Myocyte-specific Enhancer Factor 2A, Mef2, ADCAD1, RSRFC4, RSRFC9) discontinued

Sign In for Pricing
View Details