Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29)

This Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29) spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-29 IGKV2D-29

UniProt

A0A075B6S2

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQPPQLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIQLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pan troglodytes Olfactory receptor 1G1 (OR1G1)
MBS7024751-01 0.02 mg

Recombinant Pan troglodytes Olfactory receptor 1G1 (OR1G1)

Sign In for Pricing
View Details
Recombinant Pan troglodytes Olfactory receptor 1G1 (OR1G1)
MBS7024751-02 0.1 mg

Recombinant Pan troglodytes Olfactory receptor 1G1 (OR1G1)

Sign In for Pricing
View Details
Recombinant Pan troglodytes Olfactory receptor 1G1 (OR1G1)
MBS7024751-03 5x 0.1 mg

Recombinant Pan troglodytes Olfactory receptor 1G1 (OR1G1)

Sign In for Pricing
View Details
TP53I13 Blocking Peptide
33R-10291 100 ug

TP53I13 Blocking Peptide

Sign In for Pricing
View Details
IRAK3 (Interleukin-1 Receptor-Associated Kinase 3, ASRT5, FLJ13601, IRAK-M, IRAKM) (PE)
MBS6185083-01 0.1 mL

IRAK3 (Interleukin-1 Receptor-Associated Kinase 3, ASRT5, FLJ13601, IRAK-M, IRAKM) (PE)

Sign In for Pricing
View Details
IRAK3 (Interleukin-1 Receptor-Associated Kinase 3, ASRT5, FLJ13601, IRAK-M, IRAKM) (PE)
MBS6185083-02 5x 0.1 mL

IRAK3 (Interleukin-1 Receptor-Associated Kinase 3, ASRT5, FLJ13601, IRAK-M, IRAKM) (PE)

Sign In for Pricing
View Details