Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-17 (KVD17)

This Recombinant Human Immunoglobulin kappa variable 1D-17 (KVD17) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-17 IGKV1D-17

UniProt

A0A075B6S4

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NIQMTQSPSAMSASVGDRVTITCRARQGISNYLAWFQQKPGKVPKHLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Bromosalicylaldehyde
TRC-B686975-50G 50 g

5-Bromosalicylaldehyde

Sign In for Pricing
View Details
Relcovaptan
TRC-R143310-50MG 50 mg

Relcovaptan

Sign In for Pricing
View Details
SUCLA2 (NM_003850) Human Over-expression Lysate
LY401267 100 µg

SUCLA2 (NM_003850) Human Over-expression Lysate

Sign In for Pricing
View Details
Grem1 (NM_011824) Mouse Tagged ORF Clone
MG201681 10 µg

Grem1 (NM_011824) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human OR9Q2 activation kit by CRISPRa
GA116537 1 Kit

Human OR9Q2 activation kit by CRISPRa

Sign In for Pricing
View Details
Uncoated Monkey MCP-1 (Monocyte Chemotactic Protein 1) ELISA Kit
E-UNEL-MK0004-01 5x 96 Tests

Uncoated Monkey MCP-1 (Monocyte Chemotactic Protein 1) ELISA Kit

Sign In for Pricing
View Details