Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-17 (KVD17)

This Recombinant Human Immunoglobulin kappa variable 1D-17 (KVD17) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-17 IGKV1D-17

UniProt

A0A075B6S4

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NIQMTQSPSAMSASVGDRVTITCRARQGISNYLAWFQQKPGKVPKHLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Securin (PTTG1) (NM_001282382) Human Tagged ORF Clone
RG236527 10 µg

Securin (PTTG1) (NM_001282382) Human Tagged ORF Clone

Sign In for Pricing
View Details
G protein alpha Inhibitor 2 (GNAI2) Rabbit Polyclonal Antibody
TA371797 100 µL

G protein alpha Inhibitor 2 (GNAI2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2019-nCoV TaqMan RT-PCR Kit Dx-50p
DxTM67100 50 Reactions

2019-nCoV TaqMan RT-PCR Kit Dx-50p

Sign In for Pricing
View Details
Recombinant Mouse CPA2 Protein (His Tag)
PKSM040488 100 µg

Recombinant Mouse CPA2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant PRKAG3 Antibody
RN-14515-01 50 μL

Recombinant PRKAG3 Antibody

Sign In for Pricing
View Details
Recombinant PRKAG3 Antibody
RN-14515-02 100 µL

Recombinant PRKAG3 Antibody

Sign In for Pricing
View Details