Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-17 (KVD17)

This Recombinant Human Immunoglobulin kappa variable 1D-17 (KVD17) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-17 IGKV1D-17

UniProt

A0A075B6S4

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NIQMTQSPSAMSASVGDRVTITCRARQGISNYLAWFQQKPGKVPKHLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Macrophage Inflammatory Protein 1 beta (CCL4) (NM_002984) Human Tagged Lenti ORF Clone
RC210481L2 10 µg

Macrophage Inflammatory Protein 1 beta (CCL4) (NM_002984) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rhoxf10 (NM_001037581) Rat Untagged Clone
RN210249 10 µg

Rhoxf10 (NM_001037581) Rat Untagged Clone

Sign In for Pricing
View Details
Anti-Neurotrophin 3/NTF3 Antibody Picoband® Fluoro594 Conjugated
PA1062-Fluoro594 100 µg/Vial

Anti-Neurotrophin 3/NTF3 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Tex28 shRNA (UAS) - Lentiviral mouse Tex28 shRNA (UAS) plasmid
GTR15127039 1 Vial

Lentiviral mouse Tex28 shRNA (UAS) - Lentiviral mouse Tex28 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Recombinant Helicobacter Pylori pheS Protein (aa 1-328)
VAng-Lsx3479-500gEcoli 500 µg (E. coli)

Recombinant Helicobacter Pylori pheS Protein (aa 1-328)

Sign In for Pricing
View Details
Human Anti-Alpha Fodrin IgG ELISA kit, 96 tests, Quantitative
3300-160-AFG 1 kit

Human Anti-Alpha Fodrin IgG ELISA kit, 96 tests, Quantitative

Sign In for Pricing
View Details