Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulinn kappa variable 1-37 (KV137)

This Recombinant Human Probable non-functional immunoglobulinn kappa variable 1-37 (KV137) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulinn kappa variable 1-37 IGKV1-37

UniProt

A0A075B6S9

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQLTQSPSSLSASVGDRVTITCRVSQGISSYLNWYRQKPGKVPKLLIYSASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYGQRTYNAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 23 (IL23) BioAssayTM ELISA Kit (Human)
026193-01 48 Tests

Interleukin 23 (IL23) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Interleukin 23 (IL23) BioAssayTM ELISA Kit (Human)
026193-02 96 Tests

Interleukin 23 (IL23) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Anti-FEN1 Antibody Picoband® Fluoro594 Conjugated
A01484-1-Fluoro594 100 µg/Vial

Anti-FEN1 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
SRMS Rabbit Polyclonal Antibody (HRP)
orb2093738 100 µL

SRMS Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
ATP2A1 Antibody
CSB-PA188650-01 50 μL

ATP2A1 Antibody

Sign In for Pricing
View Details
ATP2A1 Antibody
CSB-PA188650-02 100 µL

ATP2A1 Antibody

Sign In for Pricing
View Details