Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 6 (TVA6)

This Recombinant Human T cell receptor alpha variable 6 (TVA6) spans the amino acid sequence from region 41-132. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 6 TRAV6 TCRAV5S1

UniProt

A0A075B6T7

Expression Region

41-132

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKIEQNSEALNIQEGKTATLTCNYTNYSPAYLQWYRQDPGRGPVFLLLIRENEKEKRKERLKVTFDTTLKQSLFHITASQPADSATYLCALD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p66 beta (GATAD2B) Rabbit Polyclonal Antibody
TA376494 100 µL

p66 beta (GATAD2B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IgD26), CF647 conjugate, 0.1mg/mL
BNC472097-500 1x 500 µL

Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IgD26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Liver
CR562998 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
Human ANKHD1 activation kit by CRISPRa
GA110339 1 Kit

Human ANKHD1 activation kit by CRISPRa

Sign In for Pricing
View Details
COL1A1 Recombinant Rabbit Monoclonal Antibody [PSH06-20]
HA722517 100 µL

COL1A1 Recombinant Rabbit Monoclonal Antibody [PSH06-20]

Sign In for Pricing
View Details
IMMP2L Human Gene Knockout Kit (CRISPR)
KN415438 1 Kit

IMMP2L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details