Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 6 (TVA6)

This Recombinant Human T cell receptor alpha variable 6 (TVA6) spans the amino acid sequence from region 41-132. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 6 TRAV6 TCRAV5S1

UniProt

A0A075B6T7

Expression Region

41-132

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKIEQNSEALNIQEGKTATLTCNYTNYSPAYLQWYRQDPGRGPVFLLLIRENEKEKRKERLKVTFDTTLKQSLFHITASQPADSATYLCALD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[SP-4-2-(1R-trans)]-(1,2-Cyclohexanediamine-N,N’) Dichloridoplatinum(II) >85%
TRC-C987466-10MG 10 mg

[SP-4-2-(1R-trans)]-(1,2-Cyclohexanediamine-N,N’) Dichloridoplatinum(II) >85%

Sign In for Pricing
View Details
BBS2 (NM_031885) Human Over-expression Lysate
LY403124 100 µg

BBS2 (NM_031885) Human Over-expression Lysate

Sign In for Pricing
View Details
LIM2 (C-term) Rabbit Polyclonal Antibody
AP52483PU-N 400 µL

LIM2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cinnarizine
TRC-C465300-5G 5 g

Cinnarizine

Sign In for Pricing
View Details
2-Acetamido-2-deoxy-4-O-(alpha-L-fucopyranosyl)-D-glucopyranose
TRC-A151550-25MG 25 mg

2-Acetamido-2-deoxy-4-O-(alpha-L-fucopyranosyl)-D-glucopyranose

Sign In for Pricing
View Details
Human UGCGL2 (UGGT2) activation kit by CRISPRa
GA110943 1 Kit

Human UGCGL2 (UGGT2) activation kit by CRISPRa

Sign In for Pricing
View Details