Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 6 (TVA6)

This Recombinant Human T cell receptor alpha variable 6 (TVA6) spans the amino acid sequence from region 41-132. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 6 TRAV6 TCRAV5S1

UniProt

A0A075B6T7

Expression Region

41-132

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKIEQNSEALNIQEGKTATLTCNYTNYSPAYLQWYRQDPGRGPVFLLLIRENEKEKRKERLKVTFDTTLKQSLFHITASQPADSATYLCALD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEY1 Peptide - middle region (AAP41453)
AAP41453-100UG 100 µg

HEY1 Peptide - middle region (AAP41453)

Sign In for Pricing
View Details
SS18 peptide
orb217971-01 1 mg

SS18 peptide

Sign In for Pricing
View Details
SS18 peptide
orb217971-02 5 mg

SS18 peptide

Sign In for Pricing
View Details
RIP2 Kinase Inhibitor 4
MBS5800023 Inquire

RIP2 Kinase Inhibitor 4

Sign In for Pricing
View Details
FBXO25-set siRNA/shRNA/RNAi Lentivector (Human)
20320091 4x 500 ng

FBXO25-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Vmn2r36 3'UTR GFP Stable Cell Line
TU172037 1.0 mL

Vmn2r36 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details