Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 9-1 (TVA91)

This Recombinant Human T cell receptor alpha variable 9-1 (TVA91) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 9-1 TRAV9-1

UniProt

A0A075B6T8

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVVQTEGQVLPSEGDSLIVNCSYETTQYPSLFWYVQYPGEGPQLHLKAMKANDKGRNKGFEAMYRKETTSFHLEKDSVQESDSAVYFCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AR/Androgen receptor Protein (N-His, Human)
P500616 100 µg

AR/Androgen receptor Protein (N-His, Human)

Sign In for Pricing
View Details
G protein reguLated inducer of neurite outgrowth 2 (GPRIN2) (NM_014696) Human Tagged Lenti ORF Clone
RC220773L4 10 µg

G protein reguLated inducer of neurite outgrowth 2 (GPRIN2) (NM_014696) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal NEDD4 Antibody [mFluor Violet 500 SE]
NBP2-97422MFV500 0.1 mL

Rabbit Polyclonal NEDD4 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Human RBP3 (Retinol Binding Protein 3, Interstitial) Microsample ELISA Kit
ELK3876MS-01 48 Tests

Human RBP3 (Retinol Binding Protein 3, Interstitial) Microsample ELISA Kit

Sign In for Pricing
View Details
Human RBP3 (Retinol Binding Protein 3, Interstitial) Microsample ELISA Kit
ELK3876MS-02 96 Tests

Human RBP3 (Retinol Binding Protein 3, Interstitial) Microsample ELISA Kit

Sign In for Pricing
View Details
Human RBP3 (Retinol Binding Protein 3, Interstitial) Microsample ELISA Kit
ELK3876MS-03 5x 96 Tests

Human RBP3 (Retinol Binding Protein 3, Interstitial) Microsample ELISA Kit

Sign In for Pricing
View Details