Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 9-1 (TVA91)

This Recombinant Human T cell receptor alpha variable 9-1 (TVA91) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 9-1 TRAV9-1

UniProt

A0A075B6T8

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVVQTEGQVLPSEGDSLIVNCSYETTQYPSLFWYVQYPGEGPQLHLKAMKANDKGRNKGFEAMYRKETTSFHLEKDSVQESDSAVYFCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal VSTM1 Antibody (01) [mFluor Violet 500 SE]
NBP3-06135MFV500 0.1 mL

Mouse Monoclonal VSTM1 Antibody (01) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
ABCC9 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
11057154 3x 1.0 µg DNA

ABCC9 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
MAGIX siRNA (Human)
orb1855596-01 15 nmol

MAGIX siRNA (Human)

Sign In for Pricing
View Details
MAGIX siRNA (Human)
orb1855596-02 30 nmol

MAGIX siRNA (Human)

Sign In for Pricing
View Details
PLA2G4A Rabbit pAb (APR17436N)
APR17436N-01 50 µL

PLA2G4A Rabbit pAb (APR17436N)

Sign In for Pricing
View Details
PLA2G4A Rabbit pAb (APR17436N)
APR17436N-02 100 µL

PLA2G4A Rabbit pAb (APR17436N)

Sign In for Pricing
View Details