Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 9-1 (TVA91)

This Recombinant Human T cell receptor alpha variable 9-1 (TVA91) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 9-1 TRAV9-1

UniProt

A0A075B6T8

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVVQTEGQVLPSEGDSLIVNCSYETTQYPSLFWYVQYPGEGPQLHLKAMKANDKGRNKGFEAMYRKETTSFHLEKDSVQESDSAVYFCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Nol4 shRNA (UAS) - Lentiviral mouse Nol4 shRNA (UAS) plasmid
GTR15256243 1 Vial

Lentiviral mouse Nol4 shRNA (UAS) - Lentiviral mouse Nol4 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Recombinant Legionella Pneumophila rpsG Protein (aa 1-175) (strain Lens)
VAng-Lsx04195-1mgEcoli 1 mg (E. coli)

Recombinant Legionella Pneumophila rpsG Protein (aa 1-175) (strain Lens)

Sign In for Pricing
View Details
IL8/CXCL8 Rabbit Polyclonal Antibody (HRP)
orb2579327 100 µg

IL8/CXCL8 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Human NUP35 Protein Lysate
MBS8416359-01 0.02 mg

Human NUP35 Protein Lysate

Sign In for Pricing
View Details
Human NUP35 Protein Lysate
MBS8416359-02 5x 0.02 mg

Human NUP35 Protein Lysate

Sign In for Pricing
View Details
Bsdc1 (NM_133889) Mouse Recombinant Protein
PM46438M5 20 µg

Bsdc1 (NM_133889) Mouse Recombinant Protein

Sign In for Pricing
View Details