Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 7 (TVA7)

This Recombinant Human T cell receptor alpha variable 7 (TVA7) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 7 TRAV7

UniProt

A0A075B6U4

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ENQVEHSPHFLGPQQGDVASMSCTYSVSRFNNLQWYRQNTGMGPKHLLSMYSAGYEKQKGRLNATLLKNGSSLYITAVQPEDSATYFCAVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-(3-Thienyl)acrylic Acid
TRC-T430030-50MG 50 mg

3-(3-Thienyl)acrylic Acid

Sign In for Pricing
View Details
MTF1 Mouse Monoclonal Antibody [Clone ID: OTI1D3]
CF805437 100 µg

MTF1 Mouse Monoclonal Antibody [Clone ID: OTI1D3]

Sign In for Pricing
View Details
APOA1BP (NAXE) (NM_144772) Human Recombinant Protein
TP321119 20 µg

APOA1BP (NAXE) (NM_144772) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Plod1 activation kit by CRISPRa
GA203293 1 Kit

Mouse Plod1 activation kit by CRISPRa

Sign In for Pricing
View Details
Hyoscine Hydrobromide Trihydrate
TRC-H674308-500MG 500 mg

Hyoscine Hydrobromide Trihydrate

Sign In for Pricing
View Details
4-fluorobutanoic acid
TRC-B439485-5MG 5 mg

4-fluorobutanoic acid

Sign In for Pricing
View Details