Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 7 (TVA7)

This Recombinant Human T cell receptor alpha variable 7 (TVA7) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 7 TRAV7

UniProt

A0A075B6U4

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ENQVEHSPHFLGPQQGDVASMSCTYSVSRFNNLQWYRQNTGMGPKHLLSMYSAGYEKQKGRLNATLLKNGSSLYITAVQPEDSATYFCAVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

cis-Dispiro[cyclohexane-1,3'-[1,2,4]trioxolane-5',2''-tricyclo[3.3.1.13,7]decane]-4-acetic Acid 1H-Benzotriazol-1-yl Ester
TRC-D784500-100MG 100 mg

cis-Dispiro[cyclohexane-1,3'-[1,2,4]trioxolane-5',2''-tricyclo[3.3.1.13,7]decane]-4-acetic Acid 1H-Benzotriazol-1-yl Ester

Sign In for Pricing
View Details
NBPF16 Human Gene Knockout Kit (CRISPR)
KN426080 1 Kit

NBPF16 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tmx4 Mouse Gene Knockout Kit (CRISPR)
KN517962 1 Kit

Tmx4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF673 (KRBOX4) (NM_017776) Human Recombinant Protein
TP761161 50 µg

ZNF673 (KRBOX4) (NM_017776) Human Recombinant Protein

Sign In for Pricing
View Details
EnzyFluo™ Custom Cell-Based ELISA Kit
EFC2R-100 100 Tests

EnzyFluo™ Custom Cell-Based ELISA Kit

Sign In for Pricing
View Details
SAPK4 (MAPK13) Human Gene Knockout Kit (CRISPR)
KN400606 1 Kit

SAPK4 (MAPK13) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details