Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 36/delta variable 7 (TVA36)

This Recombinant Human T cell receptor alpha variable 36/delta variable 7 (TVA36) spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 36/delta variable 7 TRAV36DV7

UniProt

A0A075B6V5

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDKVVQSPLSLVVHEGDTVTLNCSYEVTNFRSLLWYKQEKKAPTFLFMLTSSGIEKKSGRLSSILDKKELFSILNITATQTGDSAIYLCAVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFSF11/RANKL BioAssayTM ELISA Kit (Mouse) (Receptor Activator of Nuclear Factor kappa B Ligand) discontinued
359381-01 48 Tests

TNFSF11/RANKL BioAssayTM ELISA Kit (Mouse) (Receptor Activator of Nuclear Factor kappa B Ligand) discontinued

Sign In for Pricing
View Details
TNFSF11/RANKL BioAssayTM ELISA Kit (Mouse) (Receptor Activator of Nuclear Factor kappa B Ligand) discontinued
359381-02 96 Tests

TNFSF11/RANKL BioAssayTM ELISA Kit (Mouse) (Receptor Activator of Nuclear Factor kappa B Ligand) discontinued

Sign In for Pricing
View Details
BMPR2 (Bone Morphogenetic Protein Receptor Type-2, BMP Type-2 Receptor, BMPR-2, Bone Morphogenetic Protein Receptor Type II, BMP Type II Receptor, BMPR-II, PPH1) (MaxLight 650)
123967-ML650 100 µL

BMPR2 (Bone Morphogenetic Protein Receptor Type-2, BMP Type-2 Receptor, BMPR-2, Bone Morphogenetic Protein Receptor Type II, BMP Type II Receptor, BMPR-II, PPH1) (MaxLight 650)

Sign In for Pricing
View Details
Anti-UBE2G1 Antibody
A09806-1 100 µL

Anti-UBE2G1 Antibody

Sign In for Pricing
View Details
Nuclear Factor of activated T-cells cytoplasmic 4 (NFATC4) Human ELISA Kit
F4591 96 Tests

Nuclear Factor of activated T-cells cytoplasmic 4 (NFATC4) Human ELISA Kit

Sign In for Pricing
View Details
S100 Protein (Protein S100, S-100 Protein, S100 Calcium-binding Protein) (Not for Export EU)
138320 1 mL

S100 Protein (Protein S100, S-100 Protein, S100 Calcium-binding Protein) (Not for Export EU)

Sign In for Pricing
View Details