Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432)

This Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-2 IGHV4-30-2

UniProt

A0A087WSY4

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLQLQESGSGLVKPSQTLSLTCAVSGGSISSGGYSWSWIRQPPGKGLEWIGYIYHSGSTYYNPSLKSRVTISVDRSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD 98059
1213/50 50 mg

PD 98059

Sign In for Pricing
View Details
4- (4-Bromophenyl) -2-thiazoleacetonitrile
429046-01 100 mg

4- (4-Bromophenyl) -2-thiazoleacetonitrile

Sign In for Pricing
View Details
4- (4-Bromophenyl) -2-thiazoleacetonitrile
429046-02 250 mg

4- (4-Bromophenyl) -2-thiazoleacetonitrile

Sign In for Pricing
View Details
Cdr2l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3584306 1.0 µg DNA

Cdr2l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) CRD1 Polyclonal Antibody
MBS7187297 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) CRD1 Polyclonal Antibody

Sign In for Pricing
View Details
Biospin Total RNA Extraction Kit II
TRI-C80M1 100T

Biospin Total RNA Extraction Kit II

Sign In for Pricing
View Details