Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15)

This Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-15 IGKV3D-15

UniProt

A0A087WSY6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASIRATGIPARFSGSGSGTEFTLTISILQSEDFAVYYCQQYNNWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MLN64/STARD3 Antibody Picoband®, iFluor647 Conjugate
A05385-1-iFluor647 100 µg

Anti-MLN64/STARD3 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 8/18 Antibody (K8.8 + DC10) [HRP]
NBP2-34655H 0.1 mL

Mouse Monoclonal Cytokeratin 8/18 Antibody (K8.8 + DC10) [HRP]

Sign In for Pricing
View Details
KIF4A (Kinesin family member 4A)
321703-01 50 µg

KIF4A (Kinesin family member 4A)

Sign In for Pricing
View Details
KIF4A (Kinesin family member 4A)
321703-02 100 µg

KIF4A (Kinesin family member 4A)

Sign In for Pricing
View Details
Cytokeratin 19 Polyclonal Antibody, RBITC Conjugated
bs-15590R-RBITC 100 µL

Cytokeratin 19 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
ERP5 Antibody
orb846024 2 mg

ERP5 Antibody

Sign In for Pricing
View Details