Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15)

This Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-15 IGKV3D-15

UniProt

A0A087WSY6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASIRATGIPARFSGSGSGTEFTLTISILQSEDFAVYYCQQYNNWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdc73 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3001104 1.0 µg DNA

Cdc73 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Pcdhgb7 (NM_033579) Mouse Tagged Lenti ORF Clone
MR211220L3 10 µg

Pcdhgb7 (NM_033579) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Chicken Tissue Inhibitors Of Metalloproteinase 3 (TIMP3) ELISA Kit
RD-TIMP3-Ch-96Tests 96 Tests

Chicken Tissue Inhibitors Of Metalloproteinase 3 (TIMP3) ELISA Kit

Sign In for Pricing
View Details
Human Cytochrome P450 4A11 (CYP4A11) ELISA Kit
abx386773 96 Tests

Human Cytochrome P450 4A11 (CYP4A11) ELISA Kit

Sign In for Pricing
View Details
HMGB1 Antibody
A14353-100UG 100 µg

HMGB1 Antibody

Sign In for Pricing
View Details
Mouse Sectm1b (NM_026907) AAV Particle
MR202317A1V 250 µL

Mouse Sectm1b (NM_026907) AAV Particle

Sign In for Pricing
View Details