Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 9-2 (TVA92)

This Recombinant Human T cell receptor alpha variable 9-2 (TVA92) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 9-2 TRAV9-2

UniProt

A0A087WT02

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKGSVQVSDSAVYFCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FastGreen Q-PCR Master Mix, No Rox
Q7000-005 5x 1 mL

FastGreen Q-PCR Master Mix, No Rox

Sign In for Pricing
View Details
HCG22 siRNA Oligos set (Human)
23085171 3x 5 nmol

HCG22 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal BMP-10 Antibody [PE]
NBP2-99411PE 0.1 mL

Rabbit Polyclonal BMP-10 Antibody [PE]

Sign In for Pricing
View Details
Lentiviral mouse 4931428F04Rik shRNA (UAS) - Lentiviral mouse 4931428F04Rik shRNA (UAS, iRFP) (25)
GTR15294437 1 Vial

Lentiviral mouse 4931428F04Rik shRNA (UAS) - Lentiviral mouse 4931428F04Rik shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Mouse Monoclonal CD40 Ligand/TNFSF5 Antibody (40804) [PE/Atto594]
FAB617PEATT594 0.1 mL

Mouse Monoclonal CD40 Ligand/TNFSF5 Antibody (40804) [PE/Atto594]

Sign In for Pricing
View Details
Phospho-RB-S780 Rabbit pAb (AMR00914N)
AMR00914N-01 50 µL

Phospho-RB-S780 Rabbit pAb (AMR00914N)

Sign In for Pricing
View Details