Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 9-2 (TVA92)

This Recombinant Human T cell receptor alpha variable 9-2 (TVA92) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 9-2 TRAV9-2

UniProt

A0A087WT02

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKGSVQVSDSAVYFCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tor1aip1 siRNA Oligos set (Mouse)
47315174 3x 5 nmol

Tor1aip1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Transcription Elongation Regulator 1 (TCERG1, CA150, MGC133200, TAF2S, TATA box-binding protein-associated factor 2S, Transcription factor CA150, Urn1)
MBS602606-01 0.05 mg

Transcription Elongation Regulator 1 (TCERG1, CA150, MGC133200, TAF2S, TATA box-binding protein-associated factor 2S, Transcription factor CA150, Urn1)

Sign In for Pricing
View Details
Transcription Elongation Regulator 1 (TCERG1, CA150, MGC133200, TAF2S, TATA box-binding protein-associated factor 2S, Transcription factor CA150, Urn1)
MBS602606-02 5x 0.05 mg

Transcription Elongation Regulator 1 (TCERG1, CA150, MGC133200, TAF2S, TATA box-binding protein-associated factor 2S, Transcription factor CA150, Urn1)

Sign In for Pricing
View Details
Canine Neuroptide Y ELISA Kit
MBS734092-01 48 Well

Canine Neuroptide Y ELISA Kit

Sign In for Pricing
View Details
Canine Neuroptide Y ELISA Kit
MBS734092-02 96 Well

Canine Neuroptide Y ELISA Kit

Sign In for Pricing
View Details
Canine Neuroptide Y ELISA Kit
MBS734092-03 5x 96 Well

Canine Neuroptide Y ELISA Kit

Sign In for Pricing
View Details