Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 9-2 (TVA92)

This Recombinant Human T cell receptor alpha variable 9-2 (TVA92) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 9-2 TRAV9-2

UniProt

A0A087WT02

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKGSVQVSDSAVYFCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pBluescriptR-LIPG Plasmid
PVT52899 2 µg

pBluescriptR-LIPG Plasmid

Sign In for Pricing
View Details
λ phage DNA from E. coli
B2012946 500 µg

λ phage DNA from E. coli

Sign In for Pricing
View Details
PSuper-Puro-AMPK-shRNA2 (human)
BZ28864 1 Vial

PSuper-Puro-AMPK-shRNA2 (human)

Sign In for Pricing
View Details
Proteasome 20S beta 3 Antibody, PerCP Conjugated
bs-9357R-PerCP 100 µL

Proteasome 20S beta 3 Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Human Glutathione peroxidase 2, GPX2 ELISA KIT
E5343Hu-01 48 Well

Human Glutathione peroxidase 2, GPX2 ELISA KIT

Sign In for Pricing
View Details
Human Glutathione peroxidase 2, GPX2 ELISA KIT
E5343Hu-02 96 Well

Human Glutathione peroxidase 2, GPX2 ELISA KIT

Sign In for Pricing
View Details