Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 26-1 (TVAZ1)

This Recombinant Human T cell receptor alpha variable 26-1 (TVAZ1) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 26-1 TRAV26-1

UniProt

A0A087WT03

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPTSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQGPQYIIHGLKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse PLK1/PLK-1 Protein (His Tag)
PKSM040300 50 µg

Recombinant Mouse PLK1/PLK-1 Protein (His Tag)

Sign In for Pricing
View Details
9-Ethyl Adenine
TRC-E897175-5G 5 g

9-Ethyl Adenine

Sign In for Pricing
View Details
Vimentin Antibody
8C0390-AAT 50 µg

Vimentin Antibody

Sign In for Pricing
View Details
L-Arginine-13C,d4 Dihydrochloride
TRC-A769503-1MG 1 mg

L-Arginine-13C,d4 Dihydrochloride

Sign In for Pricing
View Details
(R)-1-[(SP)-2-(Dicyclohexylphosphino)ferrocenyl]ethyldi-tert-butylphosphine
TRC-D439235-50MG 50 mg

(R)-1-[(SP)-2-(Dicyclohexylphosphino)ferrocenyl]ethyldi-tert-butylphosphine

Sign In for Pricing
View Details
KIR3DS1 Human Gene Knockout Kit (CRISPR)
KN424158 1 Kit

KIR3DS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details