Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 26-1 (TVAZ1)

This Recombinant Human T cell receptor alpha variable 26-1 (TVAZ1) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 26-1 TRAV26-1

UniProt

A0A087WT03

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPTSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQGPQYIIHGLKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crk Mouse Gene Knockout Kit (CRISPR)
KN503836 1 Kit

Crk Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Canagliflozin Dimer
TRC-C175225-1MG 1 mg

Canagliflozin Dimer

Sign In for Pricing
View Details
Clusterin (CLU) (NM_001831) Human Recombinant Protein
TP720381M 50 µg

Clusterin (CLU) (NM_001831) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Capns1 activation kit by CRISPRa
GA200515 1 Kit

Mouse Capns1 activation kit by CRISPRa

Sign In for Pricing
View Details
Fascin-1 (FSCN1/417), CF405S conjugate, 0.1mg/mL
BNC040417-500 1x 500 µL

Fascin-1 (FSCN1/417), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]
AN00429UH-01 25 µg

PE/Cyanine7 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]

Sign In for Pricing
View Details