Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 16 (TVB16)

This Recombinant Human T cell receptor beta variable 16 (TVB16) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 16 TRBV16

UniProt

A0A087WV62

Expression Region

21-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EEVAQTPKHLVRGEGQKAKLYCAPIKGHSYVFWYQQVLKNEFKFLISFQNENVFDETGMPKERFSAKCLPNSPCSLEIQATKLEDSAVYFCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adsl sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4536707 1.0 µg DNA

Adsl sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
LHX2 Recombinant Protein (Mouse)
RP147392 100 µg

LHX2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Brilliant Violet 605™ anti-human CD83
GT08313 100 Tests

Brilliant Violet 605™ anti-human CD83

Sign In for Pricing
View Details
PDSS1 Antibody
GWB-MQ372C 50 µg

PDSS1 Antibody

Sign In for Pricing
View Details
NHP2 Rabbit pAb
E45R26234N-100 100 µL

NHP2 Rabbit pAb

Sign In for Pricing
View Details
Ambocin
M29283-01 1 g

Ambocin

Sign In for Pricing
View Details