Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome b-c1 complex subunit 6-like, mitochondrial (QCR6L)

This Recombinant Human Cytochrome b-c1 complex subunit 6-like, mitochondrial (QCR6L) spans the amino acid sequence from region 14-91. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytochrome b-c1 complex subunit 6-like, mitochondrial UQCRHL

UniProt

A0A096LP55

Expression Region

14-91

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSRSHTEEDCTEELFDFLHAKDHCVAHKLFNNLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-ERK1 (T202/Y204)/ERK2 (T185/Y187) A700 Antibody
IC1018N-100UG 100 µg

Phospho-ERK1 (T202/Y204)/ERK2 (T185/Y187) A700 Antibody

Sign In for Pricing
View Details
SERT-IN-3
HY-160655 1 Each

SERT-IN-3

Sign In for Pricing
View Details
ANO1 / TMEM16A Reference Antibody
orb1806026-01 100 µg

ANO1 / TMEM16A Reference Antibody

Sign In for Pricing
View Details
ANO1 / TMEM16A Reference Antibody
orb1806026-02 1 mg

ANO1 / TMEM16A Reference Antibody

Sign In for Pricing
View Details
ABCB5 Mouse Monoclonal Antibody
orb2958918-01 50 µg

ABCB5 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
ABCB5 Mouse Monoclonal Antibody
orb2958918-02 100 µg

ABCB5 Mouse Monoclonal Antibody

Sign In for Pricing
View Details