Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-26 (KVD26)

This Recombinant Human Immunoglobulin kappa variable 2D-26 (KVD26) spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-26 IGKV2D-26

UniProt

A0A0A0MRZ7

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVMTQTPLSLSITPGEQASMSCRSSQSLLHSDGYTYLYWFLQKARPVSTLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDFGVYYCMQDAQDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL10 (MALT-Lymphoma Marker) (BL10/2988R), CF640R conjugate, 0.1mg/mL
BNC402988-500 1x 500 µL

BCL10 (MALT-Lymphoma Marker) (BL10/2988R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FastClick™ 6-FAM Azide
72711-AAT 1 mg

FastClick™ 6-FAM Azide

Sign In for Pricing
View Details
3,4-Dihydroxybenzyl Alcohol
TRC-D493205-50MG 50 mg

3,4-Dihydroxybenzyl Alcohol

Sign In for Pricing
View Details
MSK1 (Ab-581) Antibody
8B0686-AAT 50 µg

MSK1 (Ab-581) Antibody

Sign In for Pricing
View Details
SLP76 (LCP2) Human Gene Knockout Kit (CRISPR)
KN204404 1 Kit

SLP76 (LCP2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD15/SSEA-1 Antibody[HI98]
E-AB-F1079H-01 20 Tests

PE/Cyanine7 Anti-Human CD15/SSEA-1 Antibody[HI98]

Sign In for Pricing
View Details