Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11)

This Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-11 IGKV3D-11

UniProt

A0A0A0MRZ8

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGPGTDFTLTISSLEPEDFAVYYCQQRSNWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Mrc2 Antibody
NBP2-93504-0.02mL 0.02 mL

Rabbit Polyclonal Mrc2 Antibody

Sign In for Pricing
View Details
Linoleyl alcohol
orb1298053-01 200 mg

Linoleyl alcohol

Sign In for Pricing
View Details
Linoleyl alcohol
orb1298053-02 1 ml x 10 mM (in DMSO)

Linoleyl alcohol

Sign In for Pricing
View Details
Anti-WDR33 Antibody Picoband® Fluoro488 Conjugated
A09589-1-Fluoro488 100 µg/Vial

Anti-WDR33 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
GALK1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
21210061 1.0 µg DNA

GALK1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TAT-NR2B (C-ter)
CRB1000541-01 0.5 mg

TAT-NR2B (C-ter)

Sign In for Pricing
View Details