Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11)

This Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-11 IGKV3D-11

UniProt

A0A0A0MRZ8

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGPGTDFTLTISSLEPEDFAVYYCQQRSNWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PWRN2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1762908 1.0 µg DNA

PWRN2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
PPEF1-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV741242 1.0 µg DNA

PPEF1-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Phospho-TSC2-S1387 Rabbit pAb (APR29299N)
APR29299N-01 50 µL

Phospho-TSC2-S1387 Rabbit pAb (APR29299N)

Sign In for Pricing
View Details
Phospho-TSC2-S1387 Rabbit pAb (APR29299N)
APR29299N-02 100 µL

Phospho-TSC2-S1387 Rabbit pAb (APR29299N)

Sign In for Pricing
View Details
Phospho-TSC2-S1387 Rabbit pAb (APR29299N)
APR29299N-03 200 µL

Phospho-TSC2-S1387 Rabbit pAb (APR29299N)

Sign In for Pricing
View Details
ZnAF-2F Solution
GW9813-1mg 1 mg

ZnAF-2F Solution

Sign In for Pricing
View Details