Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 3-32 (LV332)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 3-32 (LV332) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 3-32 IGLV3-32

UniProt

A0A0A0MS00

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SGPTQVPAVSVALGQMARITCQGDSMEGSYEHWYQQKPGQAPVLVIYDSSDRPSRIPERFSGSKSGNTTTLTITGAQAEDEADYYYQLIDNHATQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fgf16 (NM_021867) Rat Tagged ORF Clone Lentiviral Particle
RR205700L4V 200 µL

Fgf16 (NM_021867) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O1:K1/APEC argS Polyclonal Antibody
MBS7166958 Inquire

Rabbit anti-Escherichia coli O1:K1/APEC argS Polyclonal Antibody

Sign In for Pricing
View Details
TMEM87B shRNA Plasmid (m)
sc-154507-SH 20 µg

TMEM87B shRNA Plasmid (m)

Sign In for Pricing
View Details
ATP2A2/SERCA2 Polyclonal Conjugated Antibody
MBS9439116-01 0.1 mL (Biotin)

ATP2A2/SERCA2 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
ATP2A2/SERCA2 Polyclonal Conjugated Antibody
MBS9439116-02 0.1 mL (AF350)

ATP2A2/SERCA2 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
ATP2A2/SERCA2 Polyclonal Conjugated Antibody
MBS9439116-03 0.1 mL (AF405)

ATP2A2/SERCA2 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details