Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 5-3 (TVB53)

This Recombinant Human Probable non-functional T cell receptor beta variable 5-3 (TVB53) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 5-3 TRBV5-3

UniProt

A0A0A0MS03

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPISGHSSVSWYQQAPGQGPQFIFEYANELRRSEGNFPNRFSGRQFHDYCSEMNVSALELGDSALYLCARSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human IL-1Ra protein, His
orb86259-01 20 µg

Recombinant human IL-1Ra protein, His

Sign In for Pricing
View Details
Recombinant human IL-1Ra protein, His
orb86259-02 100 µg

Recombinant human IL-1Ra protein, His

Sign In for Pricing
View Details
Recombinant human IL-1Ra protein, His
orb86259-03 500 µg

Recombinant human IL-1Ra protein, His

Sign In for Pricing
View Details
Human GLYR1 qPCR Primer Pair
QH56229S 200 Tests

Human GLYR1 qPCR Primer Pair

Sign In for Pricing
View Details
AKAP1 Rabbit Polyclonal Antibody
TA314719 100 µL

AKAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
D 15414
MBS5811091 Inquire

D 15414

Sign In for Pricing
View Details