Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 5-3 (TVB53)

This Recombinant Human Probable non-functional T cell receptor beta variable 5-3 (TVB53) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 5-3 TRBV5-3

UniProt

A0A0A0MS03

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPISGHSSVSWYQQAPGQGPQFIFEYANELRRSEGNFPNRFSGRQFHDYCSEMNVSALELGDSALYLCARSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR108 Peptide - N-terminal region
MBS3242248-01 0.1 mg

GPR108 Peptide - N-terminal region

Sign In for Pricing
View Details
GPR108 Peptide - N-terminal region
MBS3242248-02 5x 0.1 mg

GPR108 Peptide - N-terminal region

Sign In for Pricing
View Details
POU2F1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV667603 1.0 µg DNA

POU2F1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse UPK1A shRNA Plasmid
abx980007-01 150 µg

Mouse UPK1A shRNA Plasmid

Sign In for Pricing
View Details
Mouse UPK1A shRNA Plasmid
abx980007-02 300 µg

Mouse UPK1A shRNA Plasmid

Sign In for Pricing
View Details
C9orf50 Protein Vector (Human) (pPB-N-His)
PV067030 500 ng

C9orf50 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details