Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 6-7 (TVB67)

This Recombinant Human Probable non-functional T cell receptor beta variable 6-7 (TVB67) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 6-7 TRBV6-7

UniProt

A0A0A0MS04

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHVLKTGQSMTLLCAQDMNHEYMYRYRQDPGKGLRLIYYSVAAALTDKGEVPNGYNVSRSNTEDFPLKLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Podoplanin ELISA kit
GTR10451532 96 Well

Rabbit Podoplanin ELISA kit

Sign In for Pricing
View Details
2,3-Dibromo-5-fluorobenzyl bromide
PC502268 1 Each

2,3-Dibromo-5-fluorobenzyl bromide

Sign In for Pricing
View Details
CENPA (NM_001809) Human Over-expression Lysate
E45H19654-2 20 µg

CENPA (NM_001809) Human Over-expression Lysate

Sign In for Pricing
View Details
Azin1 (NM_022585) Rat Untagged Clone
RN206887 10 µg

Azin1 (NM_022585) Rat Untagged Clone

Sign In for Pricing
View Details
Defb1-set siRNA/shRNA/RNAi Lentivector (Mouse)
17910094 4x 500 ng

Defb1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Rat Transgelin (TAGLN) ELISA Kit
abx156183-01 96 Tests

Rat Transgelin (TAGLN) ELISA Kit

Sign In for Pricing
View Details