Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 6-7 (TVB67)

This Recombinant Human Probable non-functional T cell receptor beta variable 6-7 (TVB67) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 6-7 TRBV6-7

UniProt

A0A0A0MS04

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHVLKTGQSMTLLCAQDMNHEYMYRYRQDPGKGLRLIYYSVAAALTDKGEVPNGYNVSRSNTEDFPLKLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigeon Zinc Finger Protein Basonuclin-1 (BNC1) ELISA Kit
MBS9906634 Inquire

Pigeon Zinc Finger Protein Basonuclin-1 (BNC1) ELISA Kit

Sign In for Pricing
View Details
Phospho-GATA2 (Ser401) Rabbit Polyclonal Antibody
orb157050-01 50 μL

Phospho-GATA2 (Ser401) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-GATA2 (Ser401) Rabbit Polyclonal Antibody
orb157050-02 100 µL

Phospho-GATA2 (Ser401) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-GATA2 (Ser401) Rabbit Polyclonal Antibody
orb157050-03 200 µL

Phospho-GATA2 (Ser401) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Z-Orn(Boc)-OH
C-1450.0025 25.0g

Z-Orn(Boc)-OH

Sign In for Pricing
View Details
HRH4 Polyclonal Antibody, FITC Conjugated
bs-10993R-FITC 100 µL

HRH4 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details