Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 6-7 (TVB67)

This Recombinant Human Probable non-functional T cell receptor beta variable 6-7 (TVB67) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 6-7 TRBV6-7

UniProt

A0A0A0MS04

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHVLKTGQSMTLLCAQDMNHEYMYRYRQDPGKGLRLIYYSVAAALTDKGEVPNGYNVSRSNTEDFPLKLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ETFb (Electron Transfer Flavoprotein β Polypeptide) Porcine ELISA Kit
D2631 96 Tests

ETFb (Electron Transfer Flavoprotein β Polypeptide) Porcine ELISA Kit

Sign In for Pricing
View Details
SPP1 Protein Vector (Human) (pPM-C-HA)
PV039963 500 ng

SPP1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
RGD1563888 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6029105 3x 1.0 µg

RGD1563888 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
HSP27 (D6W5V) Rabbit Monoclonal Antibody
CST 95357T 20 µL

HSP27 (D6W5V) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
EIF4G1 Human Over-expression Lysate
orb1375356 20 µg

EIF4G1 Human Over-expression Lysate

Sign In for Pricing
View Details
C9orf62 Polyclonal Antibody, PE Conjugated
bs-15335R-PE 100 µL

C9orf62 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details