Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 5-7 (TVB57)

This Recombinant Human Probable non-functional T cell receptor beta variable 5-7 (TVB57) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 5-7 TRBV5-7

UniProt

A0A0A0MS05

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQHVTLRCSPISGHTSVSSYQQALGQGPQFIFQYYEKEERGRGNFPDQFSGHQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SAT1 Antibody
NB110-41622 0.1 mL

Rabbit Polyclonal SAT1 Antibody

Sign In for Pricing
View Details
Ethyl (2Z) -3-[ (5-chloro-2-fluorophenyl) amino]-2-cyanoprop-2-enoate
sc-353328A 5 g

Ethyl (2Z) -3-[ (5-chloro-2-fluorophenyl) amino]-2-cyanoprop-2-enoate

Sign In for Pricing
View Details
Olfr248 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4241305 3x 1.0 µg

Olfr248 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Xanthomonas campestris pv. campestris Asparagine--tRNA ligase (asnS)
MBS1363115-01 0.02 mg (E-Coli)

Recombinant Xanthomonas campestris pv. campestris Asparagine--tRNA ligase (asnS)

Sign In for Pricing
View Details
Recombinant Xanthomonas campestris pv. campestris Asparagine--tRNA ligase (asnS)
MBS1363115-02 0.02 mg (Yeast)

Recombinant Xanthomonas campestris pv. campestris Asparagine--tRNA ligase (asnS)

Sign In for Pricing
View Details
Recombinant Xanthomonas campestris pv. campestris Asparagine--tRNA ligase (asnS)
MBS1363115-03 0.1 mg (E-Coli)

Recombinant Xanthomonas campestris pv. campestris Asparagine--tRNA ligase (asnS)

Sign In for Pricing
View Details