Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 5-7 (TVB57)

This Recombinant Human Probable non-functional T cell receptor beta variable 5-7 (TVB57) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 5-7 TRBV5-7

UniProt

A0A0A0MS05

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQHVTLRCSPISGHTSVSSYQQALGQGPQFIFQYYEKEERGRGNFPDQFSGHQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKB epsilon Peptide
AF6002-BP 1 mg

IKB epsilon Peptide

Sign In for Pricing
View Details
Wbp4 Mouse Gene Knockout Kit (CRISPR)
KN519323 1 Kit

Wbp4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ST6GALNAC2 Antibody, Biotin conjugated
CSB-PA883452LD01HU-01 50 µg

ST6GALNAC2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
ST6GALNAC2 Antibody, Biotin conjugated
CSB-PA883452LD01HU-02 100 µg

ST6GALNAC2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
PTPN14 Adenovirus (Rat)
38150056 1.0 mL

PTPN14 Adenovirus (Rat)

Sign In for Pricing
View Details
Human Troponin I Type 3, Cardiac (TNNI3) ELISA Kit
RD-TNNI3-Hu-96Tests 96 Tests

Human Troponin I Type 3, Cardiac (TNNI3) ELISA Kit

Sign In for Pricing
View Details