Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 5-7 (TVB57)

This Recombinant Human Probable non-functional T cell receptor beta variable 5-7 (TVB57) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 5-7 TRBV5-7

UniProt

A0A0A0MS05

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQHVTLRCSPISGHTSVSSYQQALGQGPQFIFQYYEKEERGRGNFPDQFSGHQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-LRRK2 (Thr1410) Rabbit Polyclonal Antibody (PE)
orb505532 100 µL

Phospho-LRRK2 (Thr1410) Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Rabbit anti-Cdc42GAP IHC Antibody, Affinity Purified
MBS3907884-01 0.001 mg

Rabbit anti-Cdc42GAP IHC Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-Cdc42GAP IHC Antibody, Affinity Purified
MBS3907884-02 0.01 mg

Rabbit anti-Cdc42GAP IHC Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-Cdc42GAP IHC Antibody, Affinity Purified
MBS3907884-03 5x 0.001 mg

Rabbit anti-Cdc42GAP IHC Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-Cdc42GAP IHC Antibody, Affinity Purified
MBS3907884-04 5x 0.01 mg

Rabbit anti-Cdc42GAP IHC Antibody, Affinity Purified

Sign In for Pricing
View Details
Lentiviral human CNTN3 sgRNA gene knockout kit - Lentiviral human CNTN3 sgRNA gene knockout kit (100)
GTR15365092 1 Vial

Lentiviral human CNTN3 sgRNA gene knockout kit - Lentiviral human CNTN3 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details