Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 23-1 (TVB23)

This Recombinant Human Probable non-functional T cell receptor beta variable 23-1 (TVB23) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 23-1 TRBV23-1

UniProt

A0A0A0MS06

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KVTQTPGHLVKGKGQKTKMDCTPEKGHTFVYWYQQNQNKEFMLLISFQNEQVLQETEMHKKRFSSQCPKNAPCSLAILSSEPGDTALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Complement Factor B ELISA Kit (Colorimetric)
NBP2-75244 1 Kit

Rat Complement Factor B ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
ASB4, CT (ASB4, Ankyrin repeat and SOCS box protein 4) (Azide free) (HRP)
MBS6275560-01 0.2 mL

ASB4, CT (ASB4, Ankyrin repeat and SOCS box protein 4) (Azide free) (HRP)

Sign In for Pricing
View Details
ASB4, CT (ASB4, Ankyrin repeat and SOCS box protein 4) (Azide free) (HRP)
MBS6275560-02 5x 0.2 mL

ASB4, CT (ASB4, Ankyrin repeat and SOCS box protein 4) (Azide free) (HRP)

Sign In for Pricing
View Details
Ascorbate Oxidase
P1569-1000 1 KU

Ascorbate Oxidase

Sign In for Pricing
View Details
Rabbit Polyclonal Bcl-2 related protein A1 Antibody
NB100-56070 0.05 mL

Rabbit Polyclonal Bcl-2 related protein A1 Antibody

Sign In for Pricing
View Details
Rab4A Rabbit monoclonal antibody
BS9840M 50ul

Rab4A Rabbit monoclonal antibody

Sign In for Pricing
View Details