Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-49 (HV349)

This Recombinant Human Immunoglobulin heavy variable 3-49 (HV349) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-49 IGHV3-49

UniProt

A0A0A0MS15

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVGFIRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Antibody to RPS6KB1
sAP-0669 50 µg

Mouse Monoclonal Antibody to RPS6KB1

Sign In for Pricing
View Details
Ifrd2 (NM_025903) Mouse Tagged ORF Clone
MR207033 10 µg

Ifrd2 (NM_025903) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Anti Mouse Ly-6G/Ly-6C (Gr-1) Flow Cytometry Monoclonal Clone RB68C5 Azide Free Low Endotoxin
IRTAMSLY6GRB68C5CAFLE500UG 1 Each

Anti Mouse Ly-6G/Ly-6C (Gr-1) Flow Cytometry Monoclonal Clone RB68C5 Azide Free Low Endotoxin

Sign In for Pricing
View Details
HISPPD1 Rabbit Polyclonal Antibody (Biotin)
orb2105407 100 µL

HISPPD1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
LMBR1 (Limb Region 1 Protein Homolog, Differentiation-related Gene 14 Protein, C7orf2, DIF14, ACHP, FLJ11665, PPD2, TPT) APC
MBS6137418-01 0.1 mL

LMBR1 (Limb Region 1 Protein Homolog, Differentiation-related Gene 14 Protein, C7orf2, DIF14, ACHP, FLJ11665, PPD2, TPT) APC

Sign In for Pricing
View Details
LMBR1 (Limb Region 1 Protein Homolog, Differentiation-related Gene 14 Protein, C7orf2, DIF14, ACHP, FLJ11665, PPD2, TPT) APC
MBS6137418-02 5x 0.1 mL

LMBR1 (Limb Region 1 Protein Homolog, Differentiation-related Gene 14 Protein, C7orf2, DIF14, ACHP, FLJ11665, PPD2, TPT) APC

Sign In for Pricing
View Details