Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-49 (HV349)

This Recombinant Human Immunoglobulin heavy variable 3-49 (HV349) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-49 IGHV3-49

UniProt

A0A0A0MS15

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVGFIRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human LIMCH1 pAb
PA11111-01 50 μL

Rabbit Anti-Human LIMCH1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human LIMCH1 pAb
PA11111-02 100 μL

Rabbit Anti-Human LIMCH1 pAb

Sign In for Pricing
View Details
Mouse cortistatin, CORT ELISA KIT
E1973Mo-01 48 Well

Mouse cortistatin, CORT ELISA KIT

Sign In for Pricing
View Details
Mouse cortistatin, CORT ELISA KIT
E1973Mo-02 96 Well

Mouse cortistatin, CORT ELISA KIT

Sign In for Pricing
View Details
Mouse cortistatin, CORT ELISA KIT
E1973Mo-03 5x 96 Tests

Mouse cortistatin, CORT ELISA KIT

Sign In for Pricing
View Details
Mouse cortistatin, CORT ELISA KIT
E1973Mo-04 10x 96 Tests

Mouse cortistatin, CORT ELISA KIT

Sign In for Pricing
View Details