Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 6D-21 (KVD21)

This Recombinant Human Immunoglobulin kappa variable 6D-21 (KVD21) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 6D-21 IGKV6D-21

UniProt

A0A0A0MT36

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAAAYYCHQSSSLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human MIF (Macrophage MigUncoated Ration Inhibitory Factor) ELISA Kit
E-UNEL-H0189-01 5x 96 Tests

Uncoated Human MIF (Macrophage MigUncoated Ration Inhibitory Factor) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human MIF (Macrophage MigUncoated Ration Inhibitory Factor) ELISA Kit
E-UNEL-H0189-02 15x 96 Tests

Uncoated Human MIF (Macrophage MigUncoated Ration Inhibitory Factor) ELISA Kit

Sign In for Pricing
View Details
Taps
TRC-T740305-5G 5 g

Taps

Sign In for Pricing
View Details
PEX3 (NM_003630) Human Over-expression Lysate
LC401203 20 µg

PEX3 (NM_003630) Human Over-expression Lysate

Sign In for Pricing
View Details
Creatine Kinase-BB (CK-BB) (CKBB/1268), 0.2mg/mL
BNUB1268-100 1x 100 µL

Creatine Kinase-BB (CK-BB) (CKBB/1268), 0.2mg/mL

Sign In for Pricing
View Details
LIM Kinase 1 (LIMK1) (+ LIMK2) Rabbit Polyclonal Antibody
AP06210PU-N 100 µg

LIM Kinase 1 (LIMK1) (+ LIMK2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details