Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 6D-21 (KVD21)

This Recombinant Human Immunoglobulin kappa variable 6D-21 (KVD21) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 6D-21 IGKV6D-21

UniProt

A0A0A0MT36

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAAAYYCHQSSSLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Podoplanin Antibody (PMab-1) [PerCP]
NBP3-11971PCP 0.1 mL

Rabbit Monoclonal Podoplanin Antibody (PMab-1) [PerCP]

Sign In for Pricing
View Details
Recombinant Human ATP synthase subunit beta, mitochondrial (ATP5B), partial
MBS7110819-01 0.02 mg (E-Coli)

Recombinant Human ATP synthase subunit beta, mitochondrial (ATP5B), partial

Sign In for Pricing
View Details
Recombinant Human ATP synthase subunit beta, mitochondrial (ATP5B), partial
MBS7110819-02 0.1 mg (E-Coli)

Recombinant Human ATP synthase subunit beta, mitochondrial (ATP5B), partial

Sign In for Pricing
View Details
Recombinant Human ATP synthase subunit beta, mitochondrial (ATP5B), partial
MBS7110819-03 1 mg (E-Coli)

Recombinant Human ATP synthase subunit beta, mitochondrial (ATP5B), partial

Sign In for Pricing
View Details
Recombinant Human ATP synthase subunit beta, mitochondrial (ATP5B), partial
MBS7110819-04 5x 1 mg (E-Coli)

Recombinant Human ATP synthase subunit beta, mitochondrial (ATP5B), partial

Sign In for Pricing
View Details
VEGF Antibody HRP Conjugated
MBS9460776-01 0.1 mL

VEGF Antibody HRP Conjugated

Sign In for Pricing
View Details