Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 14/delta variable 4 (TVA14)

This Recombinant Human T cell receptor alpha variable 14/delta variable 4 (TVA14) spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 14/delta variable 4 TRAV14DV4

UniProt

A0A0A6YYC5

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKITQTQPGMFVQEKEAVTLDCTYDTSDPSYGLFWYKQPSSGEMIFLIYQGSYDQQNATEGRYSLNFQKARKSANLVISASQLGDSAMYFCAMRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), 0.2mg/mL
BNUB2884-500 1x 500 µL

CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), 0.2mg/mL

Sign In for Pricing
View Details
Human F1+2 (Prothrombin Fragment 1+2) ELISA Kit
E-EL-H1793-01 24 Tests

Human F1+2 (Prothrombin Fragment 1+2) ELISA Kit

Sign In for Pricing
View Details
Human F1+2 (Prothrombin Fragment 1+2) ELISA Kit
E-EL-H1793-02 48 Tests

Human F1+2 (Prothrombin Fragment 1+2) ELISA Kit

Sign In for Pricing
View Details
Human F1+2 (Prothrombin Fragment 1+2) ELISA Kit
E-EL-H1793-03 96 Tests

Human F1+2 (Prothrombin Fragment 1+2) ELISA Kit

Sign In for Pricing
View Details
Purified Anti-Human CD10 Antibody[HI10a]
E-AB-F1141A-01 25 µg

Purified Anti-Human CD10 Antibody[HI10a]

Sign In for Pricing
View Details
Purified Anti-Human CD10 Antibody[HI10a]
E-AB-F1141A-02 100 µg

Purified Anti-Human CD10 Antibody[HI10a]

Sign In for Pricing
View Details