Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-6 (TVB66)

This Recombinant Human T cell receptor beta variable 6-6 (TVB66) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-6 TRBV6-6

UniProt

A0A0A6YYG2

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRILKIGQSMTLQCAQDMNHNYMYWYRQDPGMGLKLIYYSVGAGITDKGEVPNGYNVSRSTTEDFPLRLELAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Baff/Cd257 (B-cell Activating Factor) ELISA Kit
FY-EM1030 96 Well

Mouse Baff/Cd257 (B-cell Activating Factor) ELISA Kit

Sign In for Pricing
View Details
Human MYO1E Pre-designed siRNA Set B
SI010148B 1 Each

Human MYO1E Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant Acaryochloris marina NAD (P) H-quinone oxidoreductase subunit 3
orb2933263-01 20 µg

Recombinant Acaryochloris marina NAD (P) H-quinone oxidoreductase subunit 3

Sign In for Pricing
View Details
Recombinant Acaryochloris marina NAD (P) H-quinone oxidoreductase subunit 3
orb2933263-02 100 µg

Recombinant Acaryochloris marina NAD (P) H-quinone oxidoreductase subunit 3

Sign In for Pricing
View Details
MM.1S/NF-kB Reporter (Luc) stable cell line
GTR15424122 1 Vial

MM.1S/NF-kB Reporter (Luc) stable cell line

Sign In for Pricing
View Details
Rabbit Monoclonal CX3CL1/Fractalkine Antibody (409) [Alexa Fluor 700]
NBP2-89590AF700 0.1 mL

Rabbit Monoclonal CX3CL1/Fractalkine Antibody (409) [Alexa Fluor 700]

Sign In for Pricing
View Details